PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn046381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 652aa    MW: 73526.8 Da    PI: 6.8049
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn046381genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK45.61.4e-14265312552
      RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 i  ed+  y +l+  dAA+ L+v+ ++ Kr CR+yGI+RWP R + ++
  Achn046381 265 IPYEDILCYSKLSRCDAARYLQVSISTFKRVCRKYGISRWPPRNVDKV 312
                 66788899999999******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.162248332IPR003035RWP-RK domain
PfamPF020424.8E-12267312IPR003035RWP-RK domain
SuperFamilySSF542771.93E-9349442No hitNo description
Gene3DG3DSA:3.10.20.2402.0E-8352419No hitNo description
PfamPF005645.2E-10356418IPR000270PB1 domain
SMARTSM006665.6E-5356440IPR000270PB1 domain
PROSITE profilePS5174515.651356440IPR000270PB1 domain
PROSITE profilePS508028.591467600IPR003323OTU domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MAVILKQEMN NNNAHQYAFL EIRWVLDRVR GIYKLPLALT WVPCGACKAL LLVEDGGMLK  60
DCDGLITDLH KFTSGRLGHH LRNGIGAVGR VLSSPNLLYC SDVTQLSMVE YPLAHFAREC  120
RLRGCFAISL RSNYTGNDVY VLEIFMPTNN KDEDPLSSLS KILETMKEFK IFTLASGEVL  180
GKELSVEVIE FQNGQKHHVQ TLNVTGSLLS LEPLQNGGEI VQVDSSDHQS SDAEQCEIDG  240
NHPQELGTKK TSGREHKNTG VRIDIPYEDI LCYSKLSRCD AARYLQVSIS TFKRVCRKYG  300
ISRWPPRNVD KVHPPRPSHV DHQEVTQLNS NLPSNQASAS IAHTQPHDTV MQNANTVNVK  360
AKYVKGLTVL FPLLLSSTLE ELYECIETRL HLSRATYHAC YIDGDNDKIT ITCDQDLQFW  420
LCNSPRLPGS NAVVLHIDPI SQAYHTKSVT PLPYIDWFPA SLRPYILHVK DVALDGNCGF  480
RAIAGLMGIG EDGWVQVRRD LLTELNSHVD DYKIMYGQQR INELTHCLSW FDGHSGMDRW  540
MTMPDMGHLI ASYYNVVLYL LSHQQCLTFL PLRSVPIPAA SRREIAIGFM NNHFVEVFLL  600
SGHPVPPVAS SWTRYRSQCA QGWETTYNRR IQHFRELVDY NVTTTDAISL D*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.13e-38Nin-like family protein